Lineage for d2a4kb1 (2a4k B:3-242)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 819899Protein beta-keto acyl carrier protein reductase [51788] (8 species)
  7. 819959Species Thermus thermophilus, TTHB020 [TaxId:274] [141876] (1 PDB entry)
    Uniprot Q53WH2 2-242
  8. 819961Domain d2a4kb1: 2a4k B:3-242 [126157]
    automatically matched to 2A4K A:2-242

Details for d2a4kb1

PDB Entry: 2a4k (more details), 2.3 Å

PDB Description: 3-oxoacyl-[acyl carrier protein] reductase from thermus thermophilus tt0137
PDB Compounds: (B:) 3-oxoacyl-[acyl carrier protein] reductase

SCOP Domain Sequences for d2a4kb1:

Sequence, based on SEQRES records: (download)

>d2a4kb1 c.2.1.2 (B:3-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]}
rlsgktilvtgaasgigraaldlfaregaslvavdreerllaeavaaleaeaiavvadvs
dpkaveavfaealeefgrlhgvahfagvahsalswnlpleawekvlrvnltgsflvarka
gevleeggslvltgsvaglgafglahyaagklgvvglartlalelarkgvrvnvllpgli
qtpmtaglppwaweqevgasplgragrpeevaqaalfllseesayitgqalyvdggrsiv

Sequence, based on observed residues (ATOM records): (download)

>d2a4kb1 c.2.1.2 (B:3-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]}
rlsgktilvtgaasgigraaldlfaregaslvavdreerllaeavaaleaeaiavvadvs
dpkaveavfaealeefgrlhgvahfagvawekvlrvnltgsflvarkagevleeggslvl
tgklgvvglartlalelarkgvrvnvllpgliqaweqevgasplgragrpeevaqaalfl
lseesayitgqalyvdggrsiv

SCOP Domain Coordinates for d2a4kb1:

Click to download the PDB-style file with coordinates for d2a4kb1.
(The format of our PDB-style files is described here.)

Timeline for d2a4kb1: