Lineage for d2a4ha1 (2a4h A:62-178)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878927Family c.47.1.23: Selenoprotein W-related [142411] (4 proteins)
    Pfam PF05169; "minimalized" version of the thioredoxin-like fold
  6. 2878937Protein Selenoprotein sep15 [142412] (1 species)
  7. 2878938Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [142413] (1 PDB entry)
    Uniprot Q9VVJ7 62-178
  8. 2878939Domain d2a4ha1: 2a4h A:62-178 [126155]
    Other proteins in same PDB: d2a4ha2

Details for d2a4ha1

PDB Entry: 2a4h (more details)

PDB Description: solution structure of sep15 from drosophila melanogaster
PDB Compounds: (A:) Selenoprotein Sep15

SCOPe Domain Sequences for d2a4ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a4ha1 c.47.1.23 (A:62-178) Selenoprotein sep15 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ldqqpaaqrtyakailevctckfraypqiqafiqsgrpakfpnlqikyvrgldpvvklld
asgkvqetlsitkwntdtveeffethlakdgagknsysvvedadgdddedylrtnri

SCOPe Domain Coordinates for d2a4ha1:

Click to download the PDB-style file with coordinates for d2a4ha1.
(The format of our PDB-style files is described here.)

Timeline for d2a4ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a4ha2