SCOPe 2.08: Domain d2a4ha1: 2a4h A:62-178

Lineage for d2a4ha1 (2a4h A:62-178)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.23: Selenoprotein W-related [142411] (4 proteins)
   Pfam PF05169; "minimalized" version of the thioredoxin-like fold

6. Protein Selenoprotein sep15 [142412] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [142413] (1 PDB entry)
   Uniprot Q9VVJ7 62-178

8. Domain d2a4ha1: 2a4h A:62-178 [126155]
   Other proteins in same PDB: d2a4ha2

Details for d2a4ha1

PDB Entry: 2a4h

PDB Description: solution structure of sep15 from drosophila melanogaster

PDB Compounds: (A:) Selenoprotein Sep15

SCOPe Domain Sequences for d2a4ha1:

Sequence; same for both SEQRES and ATOM records:

>d2a4ha1 c.47.1.23 (A:62-178) Selenoprotein sep15 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ldqqpaaqrtyakailevctckfraypqiqafiqsgrpakfpnlqikyvrgldpvvklld
asgkvqetlsitkwntdtveeffethlakdgagknsysvvedadgdddedylrtnri

Timeline for d2a4ha1:

• d2a4ha1 first appeared in SCOP 1.73
  
• d2a4ha1 appears in SCOPe 2.07