Lineage for d2a4ab_ (2a4a B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2085157Family c.1.10.1: Class I aldolase [51570] (13 protein domains)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2085377Protein Fructose-1,6-bisphosphate aldolase [51576] (11 species)
  7. 2085428Species Plasmodium yoelii yoelii [TaxId:73239] [141833] (1 PDB entry)
    Uniprot Q7RMC9 3-258
  8. 2085430Domain d2a4ab_: 2a4a B: [126151]
    automated match to d2a4aa1

Details for d2a4ab_

PDB Entry: 2a4a (more details), 1.84 Å

PDB Description: Deoxyribose-phosphate aldolase from P. yoelii
PDB Compounds: (B:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d2a4ab_:

Sequence, based on SEQRES records: (download)

>d2a4ab_ c.1.10.1 (B:) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]}
nytekfaawsvicltdhtfldengteddirelcnesvktcpfaaavcvypkfvkfineki
kqeinpfkpkiacvinfpygtdsmekvlndtekalddgadeidlvinykkiientdeglk
eatkltqsvkklltnkilkviievgelktedliikttlavlngnadfiktstgkvqinat
pssveyiikaikeyiknnpeknnkiglkvsggisdlntashyillarrflsslachpdnf
rigssslviklrkvis

Sequence, based on observed residues (ATOM records): (download)

>d2a4ab_ c.1.10.1 (B:) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]}
nytekfaawsvicltdhtfldengteddirelcnesvktcpfaaavcvypkfvkfineki
kqeinpfkpkiacvinfpygtdsmekvlndtekalddgadeidlvinykkiientdeglk
eatkltqsvkklltnkilkviievgelktedliikttlavlngnadfiktstgkvqinat
pssveyiikaikeyiknnpeknnkiglkvsggisdlntashyillarrflfrigssslvi
klrkvis

SCOPe Domain Coordinates for d2a4ab_:

Click to download the PDB-style file with coordinates for d2a4ab_.
(The format of our PDB-style files is described here.)

Timeline for d2a4ab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2a4aa1