Lineage for d2a49a1 (2a49 A:26-292)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 742172Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 742173Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) (S)
  5. 742174Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (16 proteins)
  6. 742272Protein beta-Lactamase, class A [56606] (15 species)
  7. 742325Species Klebsiella pneumoniae, SHV-1 [TaxId:573] [56609] (11 PDB entries)
    inhibited by tazobactam
  8. 742329Domain d2a49a1: 2a49 A:26-292 [126149]
    automatically matched to d1rcja_
    complexed with epe, ma4, tem; mutant

Details for d2a49a1

PDB Entry: 2a49 (more details), 1.43 Å

PDB Description: crystal structure of clavulanic acid bound to e166a variant of shv-1 beta-lactamase
PDB Compounds: (A:) Beta-lactamase SHV-1

SCOP Domain Sequences for d2a49a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a49a1 e.3.1.1 (A:26-292) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-1 [TaxId: 573]}
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
agltaflrqigdnvtrldrwatelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr

SCOP Domain Coordinates for d2a49a1:

Click to download the PDB-style file with coordinates for d2a49a1.
(The format of our PDB-style files is described here.)

Timeline for d2a49a1: