SCOP 1.73: Domain d2a49a1: 2a49 A:26-292

Lineage for d2a49a1 (2a49 A:26-292)

1. Root: SCOP 1.73

2. Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (16 proteins)

6. Protein beta-Lactamase, class A [56606] (15 species)

7. Species Klebsiella pneumoniae, SHV-1 [TaxId:573] [56609] (11 PDB entries)
   inhibited by tazobactam

8. Domain d2a49a1: 2a49 A:26-292 [126149]
   automatically matched to d1rcja_
   complexed with epe, ma4, tem; mutant

Details for d2a49a1

PDB Entry: 2a49, 1.43 Å

PDB Description: crystal structure of clavulanic acid bound to e166a variant of shv-1 beta-lactamase

PDB Compounds: (A:) Beta-lactamase SHV-1

SCOP Domain Sequences for d2a49a1:

Sequence; same for both SEQRES and ATOM records:

>d2a49a1 e.3.1.1 (A:26-292) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-1 [TaxId: 573]}
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
agltaflrqigdnvtrldrwatelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr

Timeline for d2a49a1:

• d2a49a1 is new in SCOP 1.73
  
• d2a49a1 appears in SCOP 1.75
  
• d2a49a1 appears in the current release, SCOPe 2.08, called d2a49a_