![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
![]() | Superfamily d.151.1: DNase I-like [56219] (3 families) ![]() |
![]() | Family d.151.1.1: DNase I-like [56220] (6 proteins) |
![]() | Protein Deoxyribonuclease I [56225] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [56226] (10 PDB entries) |
![]() | Domain d2a41b1: 2a41 B:1-260 [126145] Other proteins in same PDB: d2a41a1, d2a41a2 automatically matched to d1dnka_ complexed with atp, bma, ca, fmt, mg, nag |
PDB Entry: 2a41 (more details), 2.6 Å
SCOP Domain Sequences for d2a41b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a41b1 d.151.1.1 (B:1-260) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]} lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg lsnemalaisdhypvevtlt
Timeline for d2a41b1: