SCOP 1.75: Domain d2a41b1: 2a41 B:1-260

Lineage for d2a41b1 (2a41 B:1-260)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (3 families)

5. Family d.151.1.1: DNase I-like [56220] (6 proteins)

6. Protein Deoxyribonuclease I [56225] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56226] (10 PDB entries)

8. Domain d2a41b1: 2a41 B:1-260 [126145]
   Other proteins in same PDB: d2a41a1, d2a41a2
   automatically matched to d1dnka_
   complexed with atp, bma, ca, fmt, mg, nag

Details for d2a41b1

PDB Entry: 2a41, 2.6 Å

PDB Description: ternary complex of the wh2 domain of wip with actin-dnase i

PDB Compounds: (B:) Deoxyribonuclease-1

SCOP Domain Sequences for d2a41b1:

Sequence; same for both SEQRES and ATOM records:

>d2a41b1 d.151.1.1 (B:1-260) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss
hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
lsnemalaisdhypvevtlt

Timeline for d2a41b1:

• d2a41b1 first appeared in SCOP 1.73
  
• d2a41b1 is called d2a41b_ in SCOPe 2.01
  
• d2a41b1 appears in the current release, SCOPe 2.08, called d2a41b_