Lineage for d2a41b1 (2a41 B:1-260)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735706Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 735707Superfamily d.151.1: DNase I-like [56219] (3 families) (S)
  5. 735708Family d.151.1.1: DNase I-like [56220] (6 proteins)
  6. 735717Protein Deoxyribonuclease I [56225] (1 species)
  7. 735718Species Cow (Bos taurus) [TaxId:9913] [56226] (9 PDB entries)
  8. 735726Domain d2a41b1: 2a41 B:1-260 [126145]
    Other proteins in same PDB: d2a41a1, d2a41a2
    automatically matched to d1dnka_
    complexed with atp, bma, ca, fmt, mg, nag

Details for d2a41b1

PDB Entry: 2a41 (more details), 2.6 Å

PDB Description: ternary complex of the wh2 domain of wip with actin-dnase i
PDB Compounds: (B:) Deoxyribonuclease-1

SCOP Domain Sequences for d2a41b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a41b1 d.151.1.1 (B:1-260) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss
hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
lsnemalaisdhypvevtlt

SCOP Domain Coordinates for d2a41b1:

Click to download the PDB-style file with coordinates for d2a41b1.
(The format of our PDB-style files is described here.)

Timeline for d2a41b1: