Lineage for d2a41b_ (2a41 B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. Protein Deoxyribonuclease I [56225] (1 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [56226] (11 PDB entries)
  8. Domain d2a41b_: 2a41 B: [126145]
    Other proteins in same PDB: d2a41a1, d2a41a2
    automated match to d1dnka_
    protein/DNA complex; complexed with atp, ca, fmt, mg

Details for d2a41b_

PDB Entry: 2a41 (more details), 2.6 Å

PDB Description: ternary complex of the wh2 domain of wip with actin-dnase i
PDB Compounds: (B:) Deoxyribonuclease-1

SCOPe Domain Sequences for d2a41b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a41b_ d.151.1.1 (B:) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss
hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
lsnemalaisdhypvevtlt

SCOPe Domain Coordinates for d2a41b_ are not available.

Timeline for d2a41b_:

Domains from other chains:
(mouse over for more information)
d2a41a1, d2a41a2