Lineage for d2a41a2 (2a41 A:147-371)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701285Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) (S)
    duplication contains two domains of this fold
  5. 701286Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 701287Protein Actin [53073] (6 species)
  7. 701298Species Cow (Bos taurus) [TaxId:9913] [53074] (25 PDB entries)
  8. 701342Domain d2a41a2: 2a41 A:147-371 [126144]
    Other proteins in same PDB: d2a41b1
    automatically matched to d1hlua2
    complexed with atp, bma, ca, fmt, mg, nag

Details for d2a41a2

PDB Entry: 2a41 (more details), 2.6 Å

PDB Description: ternary complex of the wh2 domain of wip with actin-dnase i
PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOP Domain Sequences for d2a41a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a41a2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivh

SCOP Domain Coordinates for d2a41a2:

Click to download the PDB-style file with coordinates for d2a41a2.
(The format of our PDB-style files is described here.)

Timeline for d2a41a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a41a1
View in 3D
Domains from other chains:
(mouse over for more information)
d2a41b1