SCOP 1.73: Domain d2a41a2: 2a41 A:147-371

Lineage for d2a41a2 (2a41 A:147-371)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53074] (25 PDB entries)

8. Domain d2a41a2: 2a41 A:147-371 [126144]
   Other proteins in same PDB: d2a41b1
   automatically matched to d1hlua2
   complexed with atp, bma, ca, fmt, mg, nag

Details for d2a41a2

PDB Entry: 2a41, 2.6 Å

PDB Description: ternary complex of the wh2 domain of wip with actin-dnase i

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOP Domain Sequences for d2a41a2:

Sequence; same for both SEQRES and ATOM records:

>d2a41a2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivh

Timeline for d2a41a2:

• d2a41a2 is new in SCOP 1.73
  
• d2a41a2 appears in SCOP 1.75
  
• d2a41a2 appears in the current release, SCOPe 2.08