Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
Protein Actin [53073] (6 species) |
Species Cow (Bos taurus) [TaxId:9913] [53074] (26 PDB entries) |
Domain d2a41a1: 2a41 A:7-146 [126143] Other proteins in same PDB: d2a41b1 automatically matched to d1hlua1 complexed with atp, bma, ca, fmt, mg, nag |
PDB Entry: 2a41 (more details), 2.6 Å
SCOP Domain Sequences for d2a41a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a41a1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} alvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgilt lkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfet fnvpamyvaiqavlslyasg
Timeline for d2a41a1: