SCOP 1.75: Domain d2a41a1: 2a41 A:7-146

Lineage for d2a41a1 (2a41 A:7-146)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53074] (26 PDB entries)

8. Domain d2a41a1: 2a41 A:7-146 [126143]
   Other proteins in same PDB: d2a41b1
   automatically matched to d1hlua1
   complexed with atp, bma, ca, fmt, mg, nag

Details for d2a41a1

PDB Entry: 2a41, 2.6 Å

PDB Description: ternary complex of the wh2 domain of wip with actin-dnase i

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOP Domain Sequences for d2a41a1:

Sequence; same for both SEQRES and ATOM records:

>d2a41a1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]}
alvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgilt
lkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfet
fnvpamyvaiqavlslyasg

Timeline for d2a41a1:

• d2a41a1 first appeared in SCOP 1.73
  
• d2a41a1 appears in SCOPe 2.01
  
• d2a41a1 appears in the current release, SCOPe 2.08