Lineage for d2a40e1 (2a40 E:1-260)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735706Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 735707Superfamily d.151.1: DNase I-like [56219] (3 families) (S)
  5. 735708Family d.151.1.1: DNase I-like [56220] (6 proteins)
  6. 735717Protein Deoxyribonuclease I [56225] (1 species)
  7. 735718Species Cow (Bos taurus) [TaxId:9913] [56226] (9 PDB entries)
  8. 735720Domain d2a40e1: 2a40 E:1-260 [126142]
    Other proteins in same PDB: d2a40a1, d2a40a2, d2a40d1, d2a40d2
    automatically matched to d1dnka_
    complexed with atp, ca, gol, mg, nag

Details for d2a40e1

PDB Entry: 2a40 (more details), 1.8 Å

PDB Description: ternary complex of the wh2 domain of wave with actin-dnase i
PDB Compounds: (E:) Deoxyribonuclease-1

SCOP Domain Sequences for d2a40e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a40e1 d.151.1.1 (E:1-260) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss
hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
lsnemalaisdhypvevtlt

SCOP Domain Coordinates for d2a40e1:

Click to download the PDB-style file with coordinates for d2a40e1.
(The format of our PDB-style files is described here.)

Timeline for d2a40e1: