SCOPe 2.07: Domain d2a3zb_: 2a3z B:

Lineage for d2a3zb_ (2a3z B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.1: DNase I-like [56220] (7 proteins)

6. Protein Deoxyribonuclease I [56225] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56226] (11 PDB entries)

8. Domain d2a3zb_: 2a3z B: [126136]
   Other proteins in same PDB: d2a3za1, d2a3za2
   automated match to d1dnka_
   protein/DNA complex; complexed with atp, ca, fmt, gol, mg

Details for d2a3zb_

PDB Entry: 2a3z, 2.08 Å

PDB Description: ternary complex of the wh2 domain of wasp with actin-dnase i

PDB Compounds: (B:) Deoxyribonuclease-1

SCOPe Domain Sequences for d2a3zb_:

Sequence; same for both SEQRES and ATOM records:

>d2a3zb_ d.151.1.1 (B:) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss
hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
lsnemalaisdhypvevtlt

Timeline for d2a3zb_:

• d2a3zb_ first appeared in SCOP 1.73, called d2a3zb1
  
• d2a3zb_ appears in SCOPe 2.06
  
• d2a3zb_ appears in the current release, SCOPe 2.08