Lineage for d2a3zb_ (2a3z B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988138Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2988139Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2988140Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2988149Protein Deoxyribonuclease I [56225] (1 species)
  7. 2988150Species Cow (Bos taurus) [TaxId:9913] [56226] (11 PDB entries)
  8. 2988156Domain d2a3zb_: 2a3z B: [126136]
    Other proteins in same PDB: d2a3za1, d2a3za2
    automated match to d1dnka_
    protein/DNA complex; complexed with atp, ca, fmt, gol, mg

Details for d2a3zb_

PDB Entry: 2a3z (more details), 2.08 Å

PDB Description: ternary complex of the wh2 domain of wasp with actin-dnase i
PDB Compounds: (B:) Deoxyribonuclease-1

SCOPe Domain Sequences for d2a3zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3zb_ d.151.1.1 (B:) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss
hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
lsnemalaisdhypvevtlt

SCOPe Domain Coordinates for d2a3zb_:

Click to download the PDB-style file with coordinates for d2a3zb_.
(The format of our PDB-style files is described here.)

Timeline for d2a3zb_: