Lineage for d2a3yc_ (2a3y C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2050921Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
    automatically mapped to Pfam PF00354
  6. 2051009Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. 2051010Species Human (Homo sapiens) [TaxId:9606] [49953] (12 PDB entries)
  8. 2051043Domain d2a3yc_: 2a3y C: [126131]
    automated match to d1gyka_
    complexed with ca, cpj

Details for d2a3yc_

PDB Entry: 2a3y (more details), 2 Å

PDB Description: Pentameric crystal structure of human serum amyloid P-component bound to Bis-1,2-{[(Z)-2carboxy-2-methyl-1,3-dioxane]-5-yloxycarbamoyl}-ethane.
PDB Compounds: (C:) serum amyloid p-component

SCOPe Domain Sequences for d2a3yc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3yc_ b.29.1.5 (C:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOPe Domain Coordinates for d2a3yc_:

Click to download the PDB-style file with coordinates for d2a3yc_.
(The format of our PDB-style files is described here.)

Timeline for d2a3yc_: