SCOP 1.73: Domain d2a3yc1: 2a3y C:1-204

Lineage for d2a3yc1 (2a3y C:1-204)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)

6. Protein Serum amyloid P component (SAP) [49952] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49953] (6 PDB entries)

8. Domain d2a3yc1: 2a3y C:1-204 [126131]
   automatically matched to d1gyka_
   complexed with ca, cpj

Details for d2a3yc1

PDB Entry: 2a3y, 2 Å

PDB Description: Pentameric crystal structure of human serum amyloid P-component bound to Bis-1,2-{[(Z)-2carboxy-2-methyl-1,3-dioxane]-5-yloxycarbamoyl}-ethane.

PDB Compounds: (C:) serum amyloid p-component

SCOP Domain Sequences for d2a3yc1:

Sequence; same for both SEQRES and ATOM records:

>d2a3yc1 b.29.1.5 (C:1-204) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

Timeline for d2a3yc1:

• d2a3yc1 is new in SCOP 1.73
  
• d2a3yc1 appears in SCOP 1.75
  
• d2a3yc1 appears in the current release, SCOPe 2.08, called d2a3yc_