SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2a3xj_ (2a3x J:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043320Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 protein domains)
    automatically mapped to Pfam PF00354
  6. 2043408Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. 2043409Species Human (Homo sapiens) [TaxId:9606] [49953] (12 PDB entries)
  8. 2043489Domain d2a3xj_: 2a3x J: [126128]
    automated match to d4avsa_
    complexed with ca, cpk

Details for d2a3xj_

PDB Entry: 2a3x (more details), 3 Å

PDB Description: Decameric crystal structure of human serum amyloid P-component bound to Bis-1,2-{[(Z)-2carboxy- 2-methyl-1,3-dioxane]- 5-yloxycarbonyl}-piperazine
PDB Compounds: (J:) serum amyloid p-component

SCOPe Domain Sequences for d2a3xj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3xj_ b.29.1.5 (J:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOPe Domain Coordinates for d2a3xj_:

Click to download the PDB-style file with coordinates for d2a3xj_.
(The format of our PDB-style files is described here.)

Timeline for d2a3xj_: