Lineage for d2a3xf_ (2a3x F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2389323Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
    automatically mapped to Pfam PF00354
  6. 2389411Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. 2389412Species Human (Homo sapiens) [TaxId:9606] [49953] (12 PDB entries)
  8. 2389488Domain d2a3xf_: 2a3x F: [126124]
    automated match to d4avsa_
    complexed with ca, cpk

Details for d2a3xf_

PDB Entry: 2a3x (more details), 3 Å

PDB Description: Decameric crystal structure of human serum amyloid P-component bound to Bis-1,2-{[(Z)-2carboxy- 2-methyl-1,3-dioxane]- 5-yloxycarbonyl}-piperazine
PDB Compounds: (F:) serum amyloid p-component

SCOPe Domain Sequences for d2a3xf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3xf_ b.29.1.5 (F:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOPe Domain Coordinates for d2a3xf_:

Click to download the PDB-style file with coordinates for d2a3xf_.
(The format of our PDB-style files is described here.)

Timeline for d2a3xf_: