Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins) automatically mapped to Pfam PF00354 |
Protein Serum amyloid P component (SAP) [49952] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49953] (12 PDB entries) |
Domain d2a3wp_: 2a3w P: [126114] automated match to d1gyka_ complexed with ca, cpj |
PDB Entry: 2a3w (more details), 2.2 Å
SCOPe Domain Sequences for d2a3wp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a3wp_ b.29.1.5 (P:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]} htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa nildwqalnyeirgyviikplvwv
Timeline for d2a3wp_: