Lineage for d2a3wm1 (2a3w M:1-204)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663880Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 663908Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. 663909Species Human (Homo sapiens) [TaxId:9606] [49953] (6 PDB entries)
  8. 663937Domain d2a3wm1: 2a3w M:1-204 [126111]
    automatically matched to d1gyka_
    complexed with ca, cpj

Details for d2a3wm1

PDB Entry: 2a3w (more details), 2.2 Å

PDB Description: decameric structure of human serum amyloid p-component bound to bis-1, 2-{[(z)-2-carboxy-2-methyl-1,3-dioxane]-5-yloxycarbamoyl}-ethane
PDB Compounds: (M:) serum amyloid p-component

SCOP Domain Sequences for d2a3wm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3wm1 b.29.1.5 (M:1-204) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOP Domain Coordinates for d2a3wm1:

Click to download the PDB-style file with coordinates for d2a3wm1.
(The format of our PDB-style files is described here.)

Timeline for d2a3wm1: