![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) ![]() |
![]() | Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins) |
![]() | Protein Serum amyloid P component (SAP) [49952] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49953] (6 PDB entries) |
![]() | Domain d2a3wg1: 2a3w G:1-204 [126105] automatically matched to d1gyka_ complexed with ca, cpj |
PDB Entry: 2a3w (more details), 2.2 Å
SCOP Domain Sequences for d2a3wg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a3wg1 b.29.1.5 (G:1-204) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]} htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa nildwqalnyeirgyviikplvwv
Timeline for d2a3wg1: