Lineage for d2a3rb_ (2a3r B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866454Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2866543Protein automated matches [190189] (4 species)
    not a true protein
  7. 2866551Species Human (Homo sapiens) [TaxId:9606] [186928] (11 PDB entries)
  8. 2866566Domain d2a3rb_: 2a3r B: [126095]
    automated match to d1cjma_
    complexed with a3p, ldp

Details for d2a3rb_

PDB Entry: 2a3r (more details), 2.6 Å

PDB Description: Crystal Structure of Human Sulfotransferase SULT1A3 in Complex with Dopamine and 3-Phosphoadenosine 5-Phosphate
PDB Compounds: (B:) Monoamine-sulfating phenol sulfotransferase

SCOPe Domain Sequences for d2a3rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3rb_ c.37.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rppleyvkgvplikyfaealgplqsfqarpddllintypksgttwvsqildmiyqggdle
kcnrapiyvrvpflevndpgepsgletlkdtppprlikshlplallpqtlldqkvkvvyv
arnpkdvavsyyhfhrmekahpepgtwdsflekfmagevsygswyqhvqewwelsrthpv
lylfyedmkenpkreiqkilefvgrslpeetmdfmvqhtsfkemkknpmtnyttvpqelm
dhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel

SCOPe Domain Coordinates for d2a3rb_:

Click to download the PDB-style file with coordinates for d2a3rb_.
(The format of our PDB-style files is described here.)

Timeline for d2a3rb_: