SCOPe 2.08: Domain d2a3ra_: 2a3r A:

Lineage for d2a3ra_ (2a3r A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
   Pfam PF00685
   similar to the nucleotide/nucleoside kinases but transfer sulphate group

6. Protein automated matches [190189] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186928] (11 PDB entries)

8. Domain d2a3ra_: 2a3r A: [126094]
   automated match to d1cjma_
   complexed with a3p, ldp

Details for d2a3ra_

PDB Entry: 2a3r, 2.6 Å

PDB Description: Crystal Structure of Human Sulfotransferase SULT1A3 in Complex with Dopamine and 3-Phosphoadenosine 5-Phosphate

PDB Compounds: (A:) Monoamine-sulfating phenol sulfotransferase

SCOPe Domain Sequences for d2a3ra_:

Sequence; same for both SEQRES and ATOM records:

>d2a3ra_ c.37.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rppleyvkgvplikyfaealgplqsfqarpddllintypksgttwvsqildmiyqggdle
kcnrapiyvrvpflevndpgepsgletlkdtppprlikshlplallpqtlldqkvkvvyv
arnpkdvavsyyhfhrmekahpepgtwdsflekfmagevsygswyqhvqewwelsrthpv
lylfyedmkenpkreiqkilefvgrslpeetmdfmvqhtsfkemkknpmtnyttvpqelm
dhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel

Timeline for d2a3ra_:

• d2a3ra_ first appeared in SCOP 1.73, called d2a3ra1
  
• d2a3ra_ appears in SCOPe 2.07