Lineage for d2a3la1 (2a3l A:212-839)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683612Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 683613Family c.1.9.1: Adenosine/AMP deaminase [51557] (2 proteins)
  6. 683656Protein AMP deaminase (AMPD), catalytic domain [141800] (1 species)
    elaborated fold with additional structures
  7. 683657Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141801] (1 PDB entry)
  8. 683658Domain d2a3la1: 2a3l A:212-839 [126091]
    complexed with cf5, po4, zn

Details for d2a3la1

PDB Entry: 2a3l (more details), 3.34 Å

PDB Description: x-ray structure of adenosine 5'-monophosphate deaminase from arabidopsis thaliana in complex with coformycin 5'-phosphate
PDB Compounds: (A:) AMP deaminase

SCOP Domain Sequences for d2a3la1:

Sequence, based on SEQRES records: (download)

>d2a3la1 c.1.9.1 (A:212-839) AMP deaminase (AMPD), catalytic domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe
kevisdpstpkpntepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftd
lhhvlkviaagnirtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvrkvdth
vhhsacmnqkhllrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvh
adkstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrflgeitkqvfsdleaskyqmae
yrisiygrkmsewdqlaswivnndlysenvvwliqlprlyniykdmgivtsfqnildnif
iplfeatvdpdshpqlhvflkqvvgfdlvddeskperrptkhmptpaqwtnafnpafsyy
vyycyanlyvlnklreskgmttitlrphsgeagdidhlaatfltchsiahginlrkspvl
qylyylaqiglamsplsnnslfldyhrnpfpvfflrglnvslstddplqihltkeplvee
ysiaasvwklsacdlceiarnsvyqsgfshalkshwigkdyykrgpdgndihktnvphir
vefrdtiwkeemqqvylgkavisdevvp

Sequence, based on observed residues (ATOM records): (download)

>d2a3la1 c.1.9.1 (A:212-839) AMP deaminase (AMPD), catalytic domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe
keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn
irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvrkvdthvhhsacmnqkhl
lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf
nlkynpcgqsrlreiflkqdnliqgrflgeitkqvfsdleaskyqmaeyrisiygrkmse
wdqlaswivnndlysenvvwliqlprlyniykdmgivtsfqnildnifiplfeatvdpds
hpqlhvflkqvvgfdlvddeskperrptkhmptpaqwtnafnpafsyyvyycyanlyvln
klreskgmttitlrphsgeagdidhlaatfltchsiahginlrkspvlqylyylaqigla
msplsnnslfldyhrnpfpvfflrglnvslstddplqihltkeplveeysiaasvwklsa
cdlceiarnsvyqsgfshalkshwigkdyykrgpdgndihktnvphirvefrdtiwkeem
qqvylgkavisdevvp

SCOP Domain Coordinates for d2a3la1:

Click to download the PDB-style file with coordinates for d2a3la1.
(The format of our PDB-style files is described here.)

Timeline for d2a3la1: