![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (8 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins) barrel, closed; n=8, S=12, meander |
![]() | Protein Nitrophorin 2 (prolixin-s) [50843] (1 species) |
![]() | Species Rhodnius prolixus [TaxId:13249] [50844] (14 PDB entries) |
![]() | Domain d2a3fx1: 2a3f X:0-179 [126090] automatically matched to d1euoa_ complexed with hem |
PDB Entry: 2a3f (more details), 1.4 Å
SCOP Domain Sequences for d2a3fx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a3fx1 b.60.1.1 (X:0-179) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]} mdcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyn ankktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvh iclregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl
Timeline for d2a3fx1: