Lineage for d2a3fx2 (2a3f X:1-179)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804601Protein Nitrophorin 2 (prolixin-s) [50843] (1 species)
  7. 2804602Species Rhodnius prolixus [TaxId:13249] [50844] (14 PDB entries)
    Uniprot Q26241
  8. 2804607Domain d2a3fx2: 2a3f X:1-179 [126090]
    Other proteins in same PDB: d2a3fx3
    automated match to d1euoa_
    complexed with hem

Details for d2a3fx2

PDB Entry: 2a3f (more details), 1.4 Å

PDB Description: Crystal structure of nitrophorin 2 aqua complex
PDB Compounds: (X:) Nitrophorin 2

SCOPe Domain Sequences for d2a3fx2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3fx2 b.60.1.1 (X:1-179) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]}
dcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyna
nkktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvhi
clregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl

SCOPe Domain Coordinates for d2a3fx2:

Click to download the PDB-style file with coordinates for d2a3fx2.
(The format of our PDB-style files is described here.)

Timeline for d2a3fx2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a3fx3