Lineage for d2a3cb1 (2a3c B:39-298,B:361-432)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 816441Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 816442Protein Chitinase 1 [51548] (2 species)
  7. 816443Species Aspergillus fumigatus [TaxId:5085] [117368] (14 PDB entries)
    Uniprot Q873X9
  8. 816463Domain d2a3cb1: 2a3c B:39-298,B:361-432 [126084]
    Other proteins in same PDB: d2a3ca2, d2a3cb2
    automatically matched to 1W9V A:39-298,A:361-433
    complexed with pnx, so4

Details for d2a3cb1

PDB Entry: 2a3c (more details), 2.07 Å

PDB Description: Crystal structure of Aspergillus fumigatus chitinase B1 in complex with pentoxifylline
PDB Compounds: (B:) chitinase

SCOP Domain Sequences for d2a3cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3cb1 c.1.8.5 (B:39-298,B:361-432) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]}
assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh
ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak
tavkllqdlgfdgldidweypendqqandfvlllkevrtaldsysaanaggqhflltvas
pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta
ldlyraggvpankivlgmplXdnpqvanlksgyikslglggamwwdsssdktgsdslitt
vvnalggtgvfeqsqneldypvsqydnlrngmq

SCOP Domain Coordinates for d2a3cb1:

Click to download the PDB-style file with coordinates for d2a3cb1.
(The format of our PDB-style files is described here.)

Timeline for d2a3cb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a3cb2