![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
![]() | Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
![]() | Protein Chitinase 1 [54562] (2 species) |
![]() | Species Aspergillus fumigatus [TaxId:5085] [117868] (14 PDB entries) Uniprot Q873X9 |
![]() | Domain d2a3bb2: 2a3b B:299-360 [126081] Other proteins in same PDB: d2a3ba1, d2a3bb1 automated match to d1w9pa2 complexed with cff, so4 |
PDB Entry: 2a3b (more details), 1.9 Å
SCOPe Domain Sequences for d2a3bb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a3bb2 d.26.3.1 (B:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} ygrsfantdgpgkpyngvgqgswengvwdykalpqagatehvlpdimasysydatnkfli sy
Timeline for d2a3bb2: