Lineage for d2a3ba1 (2a3b A:39-298,A:361-432)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1146554Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 1146555Protein Chitinase 1 [51548] (2 species)
  7. 1146556Species Aspergillus fumigatus [TaxId:5085] [117368] (14 PDB entries)
    Uniprot Q873X9
  8. 1146563Domain d2a3ba1: 2a3b A:39-298,A:361-432 [126078]
    Other proteins in same PDB: d2a3ba2, d2a3bb2
    automatically matched to 1W9V A:39-298,A:361-433
    complexed with cff, so4

Details for d2a3ba1

PDB Entry: 2a3b (more details), 1.9 Å

PDB Description: Crystal structure of Aspergillus fumigatus chitinase B1 in complex with caffeine
PDB Compounds: (A:) chitinase

SCOPe Domain Sequences for d2a3ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3ba1 c.1.8.5 (A:39-298,A:361-432) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]}
assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh
ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak
tavkllqdlgfdgldidweypendqqandfvlllkevrtaldsysaanaggqhflltvas
pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta
ldlyraggvpankivlgmplXdnpqvanlksgyikslglggamwwdsssdktgsdslitt
vvnalggtgvfeqsqneldypvsqydnlrngmq

SCOPe Domain Coordinates for d2a3ba1:

Click to download the PDB-style file with coordinates for d2a3ba1.
(The format of our PDB-style files is described here.)

Timeline for d2a3ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a3ba2