Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) |
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
Protein Chitinase 1 [54562] (2 species) |
Species Aspergillus fumigatus [TaxId:5085] [117868] (9 PDB entries) |
Domain d2a3ab2: 2a3a B:299-360 [126077] Other proteins in same PDB: d2a3aa1, d2a3ab1 automatically matched to 1W9V A:299-360 complexed with so4, tep |
PDB Entry: 2a3a (more details), 2.1 Å
SCOP Domain Sequences for d2a3ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a3ab2 d.26.3.1 (B:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} ygrsfantdgpgkpyngvgqgswengvwdykalpqagatehvlpdimasysydatnkfli sy
Timeline for d2a3ab2: