SCOP 1.75: Domain d2a3aa1: 2a3a A:39-298,A:361-432

Lineage for d2a3aa1 (2a3a A:39-298,A:361-432)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.5: Type II chitinase [51534] (14 proteins)
   glycosylase family 18

6. Protein Chitinase 1 [51548] (2 species)

7. Species Aspergillus fumigatus [TaxId:5085] [117368] (14 PDB entries)
   Uniprot Q873X9

8. Domain d2a3aa1: 2a3a A:39-298,A:361-432 [126074]
   Other proteins in same PDB: d2a3aa2, d2a3ab2
   automatically matched to 1W9V A:39-298,A:361-433
   complexed with so4, tep

Details for d2a3aa1

PDB Entry: 2a3a, 2.1 Å

PDB Description: Crystal structure of Aspergillus fumigatus chitinase B1 in complex with theophylline

PDB Compounds: (A:) chitinase

SCOP Domain Sequences for d2a3aa1:

Sequence; same for both SEQRES and ATOM records:

>d2a3aa1 c.1.8.5 (A:39-298,A:361-432) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]}
assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh
ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak
tavkllqdlgfdgldidweypendqqandfvlllkevrtaldsysaanaggqhflltvas
pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta
ldlyraggvpankivlgmplXdnpqvanlksgyikslglggamwwdsssdktgsdslitt
vvnalggtgvfeqsqneldypvsqydnlrngmq

Timeline for d2a3aa1:

• d2a3aa1 first appeared in SCOP 1.73
  
• d2a3aa1 appears in SCOPe 2.01
  
• d2a3aa1 appears in the current release, SCOPe 2.08