![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.5: Type II chitinase [51534] (15 proteins) glycosylase family 18 |
![]() | Protein Chitinase 1 [51548] (2 species) |
![]() | Species Aspergillus fumigatus [TaxId:5085] [117368] (14 PDB entries) Uniprot Q873X9 |
![]() | Domain d2a3aa1: 2a3a A:39-298,A:361-432 [126074] Other proteins in same PDB: d2a3aa2, d2a3ab2 automated match to d1w9pa1 complexed with so4, tep |
PDB Entry: 2a3a (more details), 2.1 Å
SCOPe Domain Sequences for d2a3aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a3aa1 c.1.8.5 (A:39-298,A:361-432) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak tavkllqdlgfdgldidweypendqqandfvlllkevrtaldsysaanaggqhflltvas pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta ldlyraggvpankivlgmplXdnpqvanlksgyikslglggamwwdsssdktgsdslitt vvnalggtgvfeqsqneldypvsqydnlrngmq
Timeline for d2a3aa1: