Lineage for d2a33a1 (2a33 A:8-190)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1885959Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 1885960Superfamily c.129.1: MCP/YpsA-like [102405] (3 families) (S)
  5. 1885961Family c.129.1.1: MoCo carrier protein-like [102406] (6 proteins)
    Pfam PF03641
  6. 1885962Protein Hypothetical protein At2g37210/T2N18.3 [142344] (1 species)
  7. 1885963Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142345] (2 PDB entries)
    Uniprot Q8L8B8 8-190
  8. 1885966Domain d2a33a1: 2a33 A:8-190 [126070]
    complexed with mg, so4

Details for d2a33a1

PDB Entry: 2a33 (more details), 1.95 Å

PDB Description: x-ray structure of a lysine decarboxylase-like protein from arabidopsis thaliana gene at2g37210
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2a33a1:

Sequence, based on SEQRES records: (download)

>d2a33a1 c.129.1.1 (A:8-190) Hypothetical protein At2g37210/T2N18.3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mqkskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmglvsqavhd
ggrhvigiipktlmpreltgetvgevravadmhqrkaemakhsdafialpggygtleell
evitwaqlgihdkpvgllnvdgyynsllsfidkaveegfisptareiivsaptakelvkk
lee

Sequence, based on observed residues (ATOM records): (download)

>d2a33a1 c.129.1.1 (A:8-190) Hypothetical protein At2g37210/T2N18.3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mqkskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmglvsqavhd
ggrhvigiipktlmvgevravadmhqrkaemakhsdafialpggygtleellevitwaql
gihdkpvgllnvdgyynsllsfidkaveegfisptareiivsaptakelvkklee

SCOPe Domain Coordinates for d2a33a1:

Click to download the PDB-style file with coordinates for d2a33a1.
(The format of our PDB-style files is described here.)

Timeline for d2a33a1: