![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
![]() | Superfamily d.68.6: AlbA-like [82704] (3 families) ![]() |
![]() | Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins) |
![]() | Protein DNA-binding protein AlbA [82706] (4 species) an archaeal chromatin protein modulated by acetylation, a Sir2 substrate |
![]() | Species Sulfolobus solfataricus, Sso10b2 [TaxId:2287] [103058] (3 PDB entries) gene SSO6877 (AlbA2) |
![]() | Domain d2a2yb_: 2a2y B: [126067] automated match to d1udva_ |
PDB Entry: 2a2y (more details)
SCOPe Domain Sequences for d2a2yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a2yb_ d.68.6.1 (B:) DNA-binding protein AlbA {Sulfolobus solfataricus, Sso10b2 [TaxId: 2287]} mteklneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdg vqlvnvqtgsevrdrrrisyillrlkrvy
Timeline for d2a2yb_: