Lineage for d2a2ya_ (2a2y A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2199715Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2200050Superfamily d.68.6: AlbA-like [82704] (3 families) (S)
  5. 2200051Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins)
  6. 2200052Protein DNA-binding protein AlbA [82706] (4 species)
    an archaeal chromatin protein modulated by acetylation, a Sir2 substrate
  7. 2200063Species Sulfolobus solfataricus, Sso10b2 [TaxId:2287] [103058] (3 PDB entries)
    gene SSO6877 (AlbA2)
  8. 2200068Domain d2a2ya_: 2a2y A: [126066]
    automated match to d1udva_

Details for d2a2ya_

PDB Entry: 2a2y (more details)

PDB Description: NMR Structue of Sso10b2 from Sulfolobus solfataricus
PDB Compounds: (A:) DNA/RNA-binding protein Alba 2

SCOPe Domain Sequences for d2a2ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a2ya_ d.68.6.1 (A:) DNA-binding protein AlbA {Sulfolobus solfataricus, Sso10b2 [TaxId: 2287]}
mteklneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdg
vqlvnvqtgsevrdrrrisyillrlkrvy

SCOPe Domain Coordinates for d2a2ya_:

Click to download the PDB-style file with coordinates for d2a2ya_.
(The format of our PDB-style files is described here.)

Timeline for d2a2ya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2a2yb_