Lineage for d2a2ya1 (2a2y A:2-89)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726532Fold d.68: IF3-like [55199] (7 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 726672Superfamily d.68.6: AlbA-like [82704] (2 families) (S)
  5. 726673Family d.68.6.1: DNA-binding protein AlbA [82705] (1 protein)
  6. 726674Protein DNA-binding protein AlbA [82706] (4 species)
    an archaeal chromatin protein modulated by acetylation, a Sir2 substrate
  7. 726687Species Archaeon Sulfolobus solfataricus, Sso10b2 [TaxId:2287] [103058] (3 PDB entries)
    gene SSO6877 (AlbA2)
  8. 726692Domain d2a2ya1: 2a2y A:2-89 [126066]
    automatically matched to d1udva_

Details for d2a2ya1

PDB Entry: 2a2y (more details)

PDB Description: nmr structue of sso10b2 from sulfolobus solfataricus
PDB Compounds: (A:) DNA/RNA-binding protein Alba 2

SCOP Domain Sequences for d2a2ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a2ya1 d.68.6.1 (A:2-89) DNA-binding protein AlbA {Archaeon Sulfolobus solfataricus, Sso10b2 [TaxId: 2287]}
teklneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdgv
qlvnvqtgsevrdrrrisyillrlkrvy

SCOP Domain Coordinates for d2a2ya1:

Click to download the PDB-style file with coordinates for d2a2ya1.
(The format of our PDB-style files is described here.)

Timeline for d2a2ya1: