Lineage for d2a2sa1 (2a2s A:78-209)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 769705Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 769706Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 769707Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 769985Protein Class pi GST [81347] (4 species)
  7. 769986Species Human (Homo sapiens) [TaxId:9606] [47619] (41 PDB entries)
  8. 769991Domain d2a2sa1: 2a2s A:78-209 [126062]
    Other proteins in same PDB: d2a2sa2, d2a2sb2
    automatically matched to d10gsa1
    complexed with ca, co3, gsn, mes

Details for d2a2sa1

PDB Entry: 2a2s (more details), 1.7 Å

PDB Description: Crystal Structure of Human Glutathione Transferase in complex with S-nitrosoglutathione in the absence of reducing agent
PDB Compounds: (A:) Glutathione S-transferase P

SCOP Domain Sequences for d2a2sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a2sa1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
lygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqnq
ggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspe
yvnlpingngkq

SCOP Domain Coordinates for d2a2sa1:

Click to download the PDB-style file with coordinates for d2a2sa1.
(The format of our PDB-style files is described here.)

Timeline for d2a2sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a2sa2