SCOP 1.73: Domain d2a2qt2: 2a2q T:109-209

Lineage for d2a2qt2 (2a2q T:109-209)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries)

8. Domain d2a2qt2: 2a2q T:109-209 [126057]
   Other proteins in same PDB: d2a2qh1, d2a2ql1, d2a2ql2, d2a2ql3
   automatically matched to d1a21a2
   complexed with ca, cl, fuc, glc, mg, na, pbz, zn

Details for d2a2qt2

PDB Entry: 2a2q, 1.8 Å

PDB Description: complex of active-site inhibited human coagulation factor viia with human soluble tissue factor in the presence of ca2+, mg2+, na+, and zn2+

PDB Compounds: (T:) tissue factor

SCOP Domain Sequences for d2a2qt2:

Sequence, based on SEQRES records:

>d2a2qt2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkkta
ktntneflidvdkgenycfsvqavipsrtvnrkstdspvec

Sequence, based on observed residues (ATOM records):

>d2a2qt2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywktaktntnef
lidvdkgenycfsvqavipsrtvnrkstdspvec

Timeline for d2a2qt2:

• d2a2qt2 is new in SCOP 1.73
  
• d2a2qt2 appears in SCOP 1.75
  
• d2a2qt2 appears in the current release, SCOPe 2.08