SCOPe 2.05: Domain d2a2qt1: 2a2q T:6-106

Lineage for d2a2qt1 (2a2q T:6-106)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries)
   Uniprot P13726 33-242

8. Domain d2a2qt1: 2a2q T:6-106 [126056]
   Other proteins in same PDB: d2a2qh_, d2a2ql1, d2a2ql2, d2a2ql3
   automated match to d1uj3c1
   complexed with ca, cl, fuc, glc, mg, na, pbz, zn

Details for d2a2qt1

PDB Entry: 2a2q, 1.8 Å

PDB Description: complex of active-site inhibited human coagulation factor viia with human soluble tissue factor in the presence of ca2+, mg2+, na+, and zn2+

PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d2a2qt1:

Sequence, based on SEQRES records:

>d2a2qt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records):

>d2a2qt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagngeplyenspeftpylet

Timeline for d2a2qt1:

• d2a2qt1 first appeared in SCOP 1.73
  
• d2a2qt1 appears in SCOPe 2.04
  
• d2a2qt1 appears in SCOPe 2.06
  
• d2a2qt1 appears in the current release, SCOPe 2.08