Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (43 proteins) Pfam PF00041 |
Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries) |
Domain d2a2qt1: 2a2q T:6-108 [126056] Other proteins in same PDB: d2a2qh1, d2a2ql1, d2a2ql2, d2a2ql3 automatically matched to d1a21a1 complexed with ca, cl, fuc, glc, mg, na, pbz, zn |
PDB Entry: 2a2q (more details), 1.8 Å
SCOP Domain Sequences for d2a2qt1:
Sequence, based on SEQRES records: (download)
>d2a2qt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk dvkqtylarvfsypagnvestgsageplyenspeftpyletnl
>d2a2qt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk dvkqtylarvfsypagngeplyenspeftpyletnl
Timeline for d2a2qt1:
View in 3D Domains from other chains: (mouse over for more information) d2a2qh1, d2a2ql1, d2a2ql2, d2a2ql3 |