Lineage for d2a2ql2 (2a2q L:91-140)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061532Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1062283Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 1062284Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1062362Protein Factor IX (IXa) [57198] (2 species)
  7. 1062376Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries)
  8. 1062380Domain d2a2ql2: 2a2q L:91-140 [126054]
    Other proteins in same PDB: d2a2qh_, d2a2ql3, d2a2qt1, d2a2qt2
    automatically matched to d1pfxl2
    complexed with ca, cl, fuc, glc, mg, na, pbz, zn

Details for d2a2ql2

PDB Entry: 2a2q (more details), 1.8 Å

PDB Description: Complex of Active-site Inhibited Human Coagulation Factor VIIa with Human Soluble Tissue Factor in the Presence of Ca2+, Mg2+, Na+, and Zn2+
PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d2a2ql2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a2ql2 g.3.11.1 (L:91-140) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
cvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipi

SCOPe Domain Coordinates for d2a2ql2:

Click to download the PDB-style file with coordinates for d2a2ql2.
(The format of our PDB-style files is described here.)

Timeline for d2a2ql2: