SCOP 1.73: Domain d2a2ql1: 2a2q L:46-82

Lineage for d2a2ql1 (2a2q L:46-82)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (22 proteins)

6. Protein Factor IX (IXa) [57198] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries)

8. Domain d2a2ql1: 2a2q L:46-82 [126053]
   Other proteins in same PDB: d2a2qh1, d2a2ql3, d2a2qt1, d2a2qt2
   automatically matched to d1pfxl1
   complexed with ca, cl, fuc, glc, mg, na, pbz, zn

Details for d2a2ql1

PDB Entry: 2a2q, 1.8 Å

PDB Description: complex of active-site inhibited human coagulation factor viia with human soluble tissue factor in the presence of ca2+, mg2+, na+, and zn2+

PDB Compounds: (L:) Coagulation factor VII

SCOP Domain Sequences for d2a2ql1:

Sequence; same for both SEQRES and ATOM records:

>d2a2ql1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
dgdqcasspcqnggsckdqlqsyicfclpafegrnce

Timeline for d2a2ql1:

• d2a2ql1 is new in SCOP 1.73
  
• d2a2ql1 appears in SCOP 1.75
  
• d2a2ql1 appears in the current release, SCOPe 2.08