Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Coagulation factor VIIa [50550] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50551] (90 PDB entries) Uniprot P08709 213-466 ! Uniprot P08709 213-446 |
Domain d2a2qh_: 2a2q H: [126052] Other proteins in same PDB: d2a2ql1, d2a2ql2, d2a2ql3, d2a2qt1, d2a2qt2 automated match to d1cvwh_ complexed with ca, cl, fuc, glc, mg, na, pbz, zn |
PDB Entry: 2a2q (more details), 1.8 Å
SCOPe Domain Sequences for d2a2qh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a2qh_ b.47.1.2 (H:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkvgdspniteymfcagy sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr seprpgvllrapfp
Timeline for d2a2qh_: