Lineage for d2a2pa1 (2a2p A:25-144)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878927Family c.47.1.23: Selenoprotein W-related [142411] (4 proteins)
    Pfam PF05169; "minimalized" version of the thioredoxin-like fold
  6. 2878934Protein Selenoprotein M [142416] (1 species)
  7. 2878935Species Mouse (Mus musculus) [TaxId:10090] [142417] (1 PDB entry)
    Uniprot Q8VHC3 25-144
  8. 2878936Domain d2a2pa1: 2a2p A:25-144 [126051]
    Other proteins in same PDB: d2a2pa2

Details for d2a2pa1

PDB Entry: 2a2p (more details)

PDB Description: solution structure of selm from mus musculus
PDB Compounds: (A:) Selenoprotein M

SCOPe Domain Sequences for d2a2pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a2pa1 c.47.1.23 (A:25-144) Selenoprotein M {Mouse (Mus musculus) [TaxId: 10090]}
tnyrpdwnrlrglargrvetcggcqlnrlkevkafvtediqlyhnlvmkhlpgadpelvl
lsrnyqeleriplsqmtrdeinalvqelgfyrksapeaqvppeylwapakppeeasehdd

SCOPe Domain Coordinates for d2a2pa1:

Click to download the PDB-style file with coordinates for d2a2pa1.
(The format of our PDB-style files is described here.)

Timeline for d2a2pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a2pa2