| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.23: Selenoprotein W-related [142411] (4 proteins) Pfam PF05169; "minimalized" version of the thioredoxin-like fold |
| Protein Selenoprotein M [142416] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [142417] (1 PDB entry) Uniprot Q8VHC3 25-144 |
| Domain d2a2pa1: 2a2p A:25-144 [126051] Other proteins in same PDB: d2a2pa2 |
PDB Entry: 2a2p (more details)
SCOPe Domain Sequences for d2a2pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a2pa1 c.47.1.23 (A:25-144) Selenoprotein M {Mouse (Mus musculus) [TaxId: 10090]}
tnyrpdwnrlrglargrvetcggcqlnrlkevkafvtediqlyhnlvmkhlpgadpelvl
lsrnyqeleriplsqmtrdeinalvqelgfyrksapeaqvppeylwapakppeeasehdd
Timeline for d2a2pa1: