Lineage for d2a2oe_ (2a2o E:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1749970Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 1749971Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 1750124Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 1750125Protein Hypothetical protein BT3146 [140956] (1 species)
  7. 1750126Species Bacteroides thetaiotaomicron [TaxId:818] [140957] (2 PDB entries)
    Uniprot Q8A309 10-240
  8. 1750133Domain d2a2oe_: 2a2o E: [126048]
    automated match to d2a2ma1
    complexed with edo, k

Details for d2a2oe_

PDB Entry: 2a2o (more details), 2.16 Å

PDB Description: crystal structure of a putativetena family transcriptional regulator (bt_3146) from bacteroides thetaiotaomicron vpi-5482 at 2.16 a resolution
PDB Compounds: (E:) hypothetical protein BT3146

SCOPe Domain Sequences for d2a2oe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a2oe_ a.132.1.3 (E:) Hypothetical protein BT3146 {Bacteroides thetaiotaomicron [TaxId: 818]}
rkrtfaipasrltgrlttlksdvpaadslfwklwngsldtavqvlqtdyfkgiaagtldp
naygslmvqdgyycfrgrddyataatcaqdetlreffkakaksydeynetyhqtwhlrea
sglipgtdikdyadyeayvagslaspymcvvmlpceylwpwianfldgytptnslyrfwi
ewnggtpngayqmgnmleqyrdkidedkaveifntamnyelkvftsstil

SCOPe Domain Coordinates for d2a2oe_:

Click to download the PDB-style file with coordinates for d2a2oe_.
(The format of our PDB-style files is described here.)

Timeline for d2a2oe_: