Lineage for d2a2ob1 (2a2o B:10-239)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648983Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 648984Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 649094Family a.132.1.3: TENA/THI-4 [101458] (8 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 649095Protein Hypothetical protein BT3146 [140956] (1 species)
  7. 649096Species Bacteroides thetaiotaomicron [TaxId:818] [140957] (2 PDB entries)
  8. 649100Domain d2a2ob1: 2a2o B:10-239 [126045]
    automatically matched to 2A2M A:10-240
    complexed with edo, k

Details for d2a2ob1

PDB Entry: 2a2o (more details), 2.16 Å

PDB Description: crystal structure of a putativetena family transcriptional regulator (bt_3146) from bacteroides thetaiotaomicron vpi-5482 at 2.16 a resolution
PDB Compounds: (B:) hypothetical protein BT3146

SCOP Domain Sequences for d2a2ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a2ob1 a.132.1.3 (B:10-239) Hypothetical protein BT3146 {Bacteroides thetaiotaomicron [TaxId: 818]}
rkrtfaipasrltgrlttlksdvpaadslfwklwngsldtavqvlqtdyfkgiaagtldp
naygslmvqdgyycfrgrddyataatcaqdetlreffkakaksydeynetyhqtwhlrea
sglipgtdikdyadyeayvagslaspymcvvmlpceylwpwianfldgytptnslyrfwi
ewnggtpngayqmgnmleqyrdkidedkaveifntamnyelkvftsstil

SCOP Domain Coordinates for d2a2ob1:

Click to download the PDB-style file with coordinates for d2a2ob1.
(The format of our PDB-style files is described here.)

Timeline for d2a2ob1: