![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
![]() | Family a.132.1.3: TENA/THI-4 [101458] (9 proteins) Pfam PF03070; HO-related family lacking the heme-binding site |
![]() | Protein Hypothetical protein BT3146 [140956] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [140957] (2 PDB entries) Uniprot Q8A309 10-240 |
![]() | Domain d2a2oa_: 2a2o A: [126044] automated match to d2a2ma1 complexed with edo, k |
PDB Entry: 2a2o (more details), 2.16 Å
SCOPe Domain Sequences for d2a2oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a2oa_ a.132.1.3 (A:) Hypothetical protein BT3146 {Bacteroides thetaiotaomicron [TaxId: 818]} rkrtfaipasrltgrlttlksdvpaadslfwklwngsldtavqvlqtdyfkgiaagtldp naygslmvqdgyycfrgrddyataatcaqdetlreffkakaksydeynetyhqtwhlrea sglipgtdikdyadyeayvagslaspymcvvmlpceylwpwianfldgytptnslyrfwi ewnggtpngayqmgnmleqyrdkidedkaveifntamnyelkvftsstil
Timeline for d2a2oa_: