SCOPe 2.06: Domain d2a2nc_: 2a2n C:

Lineage for d2a2nc_ (2a2n C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain [141515] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141516] (1 PDB entry)
   Uniprot Q96BP3 483-646

8. Domain d2a2nc_: 2a2n C: [126043]
   automated match to d2a2na1
   complexed with gol

Details for d2a2nc_

PDB Entry: 2a2n, 1.65 Å

PDB Description: Crystal Structure of the peptidylprolyl isomerase domain of Human PPWD1

PDB Compounds: (C:) peptidylprolyl isomerase domain and WD repeat containing 1

SCOPe Domain Sequences for d2a2nc_:

Sequence; same for both SEQRES and ATOM records:

>d2a2nc_ b.62.1.1 (C:) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tqaegpkrvsdsaiihtsmgdihtklfpvecpktvenfcvhsrngyynghtfhriikgfm
iqtgdptgtgmggesiwggefedefhstlrhdrpytlsmanagsntngsqffitvvptpw
ldnkhtvfgrvtkgmevvqrisnvkvnpktdkpyedvsiinitvk

Timeline for d2a2nc_:

• d2a2nc_ first appeared in SCOP 1.73, called d2a2nc1
  
• d2a2nc_ appears in SCOPe 2.05
  
• d2a2nc_ appears in SCOPe 2.07
  
• d2a2nc_ appears in the current release, SCOPe 2.08