Lineage for d2a2nb1 (2a2n B:483-646)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674493Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 674494Superfamily b.62.1: Cyclophilin-like [50891] (3 families) (S)
  5. 674495Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)
  6. 674692Protein Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain [141515] (1 species)
  7. 674693Species Human (Homo sapiens) [TaxId:9606] [141516] (1 PDB entry)
  8. 674695Domain d2a2nb1: 2a2n B:483-646 [126042]
    automatically matched to 2A2N A:483-646
    complexed with gol

Details for d2a2nb1

PDB Entry: 2a2n (more details), 1.65 Å

PDB Description: Crystal Structure of the peptidylprolyl isomerase domain of Human PPWD1
PDB Compounds: (B:) peptidylprolyl isomerase domain and WD repeat containing 1

SCOP Domain Sequences for d2a2nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a2nb1 b.62.1.1 (B:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qaegpkrvsdsaiihtsmgdihtklfpvecpktvenfcvhsrngyynghtfhriikgfmi
qtgdptgtgmggesiwggefedefhstlrhdrpytlsmanagsntngsqffitvvptpwl
dnkhtvfgrvtkgmevvqrisnvkvnpktdkpyedvsiinitvk

SCOP Domain Coordinates for d2a2nb1:

Click to download the PDB-style file with coordinates for d2a2nb1.
(The format of our PDB-style files is described here.)

Timeline for d2a2nb1: