SCOP 1.73: Domain d2a2nb1: 2a2n B:483-646

Lineage for d2a2nb1 (2a2n B:483-646)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (3 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)

6. Protein Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain [141515] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141516] (1 PDB entry)

8. Domain d2a2nb1: 2a2n B:483-646 [126042]
   automatically matched to 2A2N A:483-646
   complexed with gol

Details for d2a2nb1

PDB Entry: 2a2n, 1.65 Å

PDB Description: Crystal Structure of the peptidylprolyl isomerase domain of Human PPWD1

PDB Compounds: (B:) peptidylprolyl isomerase domain and WD repeat containing 1

SCOP Domain Sequences for d2a2nb1:

Sequence; same for both SEQRES and ATOM records:

>d2a2nb1 b.62.1.1 (B:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qaegpkrvsdsaiihtsmgdihtklfpvecpktvenfcvhsrngyynghtfhriikgfmi
qtgdptgtgmggesiwggefedefhstlrhdrpytlsmanagsntngsqffitvvptpwl
dnkhtvfgrvtkgmevvqrisnvkvnpktdkpyedvsiinitvk

Timeline for d2a2nb1:

• d2a2nb1 is new in SCOP 1.73
  
• d2a2nb1 appears in SCOP 1.75
  
• d2a2nb1 appears in the current release, SCOPe 2.08, called d2a2nb_