SCOP 1.73: Domain d2a2mb1: 2a2m B:10-240

Lineage for d2a2mb1 (2a2m B:10-240)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (8 proteins)
   Pfam PF03070; HO-related family lacking the heme-binding site

6. Protein Hypothetical protein BT3146 [140956] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [140957] (2 PDB entries)

8. Domain d2a2mb1: 2a2m B:10-240 [126040]
   automatically matched to 2A2M A:10-240
   complexed with act, edo

Details for d2a2mb1

PDB Entry: 2a2m, 1.88 Å

PDB Description: crystal structure of a putativetena family transcriptional regulator (bt_3146) from bacteroides thetaiotaomicron vpi-5482 at 1.88 a resolution

PDB Compounds: (B:) hypothetical protein BT3146

SCOP Domain Sequences for d2a2mb1:

Sequence; same for both SEQRES and ATOM records:

>d2a2mb1 a.132.1.3 (B:10-240) Hypothetical protein BT3146 {Bacteroides thetaiotaomicron [TaxId: 818]}
rkrtfaipasrltgrlttlksdvpaadslfwklwngsldtavqvlqtdyfkgiaagtldp
naygslmvqdgyycfrgrddyataatcaqdetlreffkakaksydeynetyhqtwhlrea
sglipgtdikdyadyeayvagslaspymcvvmlpceylwpwianfldgytptnslyrfwi
ewnggtpngayqmgnmleqyrdkidedkaveifntamnyelkvftsstilt

Timeline for d2a2mb1:

• d2a2mb1 is new in SCOP 1.73
  
• d2a2mb1 appears in SCOP 1.75
  
• d2a2mb1 appears in the current release, SCOPe 2.08, called d2a2mb_