SCOPe 2.08: Domain d2a2mb_: 2a2m B:

Lineage for d2a2mb_ (2a2m B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
   Pfam PF03070; HO-related family lacking the heme-binding site

6. Protein Hypothetical protein BT3146 [140956] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [140957] (2 PDB entries)
   Uniprot Q8A309 10-240

8. Domain d2a2mb_: 2a2m B: [126040]
   automated match to d2a2ma1
   complexed with act, edo

Details for d2a2mb_

PDB Entry: 2a2m, 1.88 Å

PDB Description: crystal structure of a putativetena family transcriptional regulator (bt_3146) from bacteroides thetaiotaomicron vpi-5482 at 1.88 a resolution

PDB Compounds: (B:) hypothetical protein BT3146

SCOPe Domain Sequences for d2a2mb_:

Sequence; same for both SEQRES and ATOM records:

>d2a2mb_ a.132.1.3 (B:) Hypothetical protein BT3146 {Bacteroides thetaiotaomicron [TaxId: 818]}
rkrtfaipasrltgrlttlksdvpaadslfwklwngsldtavqvlqtdyfkgiaagtldp
naygslmvqdgyycfrgrddyataatcaqdetlreffkakaksydeynetyhqtwhlrea
sglipgtdikdyadyeayvagslaspymcvvmlpceylwpwianfldgytptnslyrfwi
ewnggtpngayqmgnmleqyrdkidedkaveifntamnyelkvftsstilt

Timeline for d2a2mb_:

• d2a2mb_ first appeared in SCOP 1.73, called d2a2mb1
  
• d2a2mb_ appears in SCOPe 2.07