Lineage for d2a2ma1 (2a2m A:10-240)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732777Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 2732778Protein Hypothetical protein BT3146 [140956] (1 species)
  7. 2732779Species Bacteroides thetaiotaomicron [TaxId:818] [140957] (2 PDB entries)
    Uniprot Q8A309 10-240
  8. 2732780Domain d2a2ma1: 2a2m A:10-240 [126039]
    complexed with act, edo

Details for d2a2ma1

PDB Entry: 2a2m (more details), 1.88 Å

PDB Description: crystal structure of a putativetena family transcriptional regulator (bt_3146) from bacteroides thetaiotaomicron vpi-5482 at 1.88 a resolution
PDB Compounds: (A:) hypothetical protein BT3146

SCOPe Domain Sequences for d2a2ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a2ma1 a.132.1.3 (A:10-240) Hypothetical protein BT3146 {Bacteroides thetaiotaomicron [TaxId: 818]}
rkrtfaipasrltgrlttlksdvpaadslfwklwngsldtavqvlqtdyfkgiaagtldp
naygslmvqdgyycfrgrddyataatcaqdetlreffkakaksydeynetyhqtwhlrea
sglipgtdikdyadyeayvagslaspymcvvmlpceylwpwianfldgytptnslyrfwi
ewnggtpngayqmgnmleqyrdkidedkaveifntamnyelkvftsstilt

SCOPe Domain Coordinates for d2a2ma1:

Click to download the PDB-style file with coordinates for d2a2ma1.
(The format of our PDB-style files is described here.)

Timeline for d2a2ma1: